PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00134216001
Common NameGSBRNA2T00134216001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 407aa    MW: 42883.2 Da    PI: 8.6563
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00134216001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-3890149362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  GSBRNA2T00134216001  90 ETALKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 149
                          6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3973147IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3292147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39493147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MVFSSFPTYP DSSNWQQQHQ PITSTVGFTG DNNISQQFLP HHPLPPQPQQ TPPPLHHNGG  60
GGGGPGGPGG SIRPGSMAER ARIANIPMPE TALKCPRCDS TNTKFCYFNN YSLTQPRHFC  120
KACRRYWTRG GALRSVPVGG GCRRNKRTKN SSGGGGGGSS CSGNSKSQDS NTSSDQYHDR  180
AMANNQMGPP PSSTSLSSLL SSYNAGLIPG HDHNNNNILG LGSSLPPLKL MPPLDFTDNF  240
TLQYGTVSAP SYHVGGGSGG GGGAEALLTG FDQWRFPAPH HQLPLLGGLD SSSSSSGLYQ  300
FDHQNQTGMD PGYGLVTSSG QYRPKNIFHN LVSSSVSSAM VTATASQLAS VKMEDSNNQL  360
NMSRQLFGTE QQLWNIHGSA ASAAAATTSS WSDVSINFSS SSTSNI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.145381e-122seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00134216001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410230.0AC241023.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039N20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625612.10.0PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9LZ561e-160DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A078CVP10.0A0A078CVP1_BRANA; BnaC03g00760D protein
STRINGBra005725.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-130Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]